PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.0568s0257.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 317aa    MW: 35224.1 Da    PI: 4.6936
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.0568s0257.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.3e-1972125356
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          k+++++ eq+++Le+ Fe ++++  +++ +LA++lgL+ rqV +WFqNrRa++k
  Bostr.0568s0257.1.p  72 KKRRLSVEQVKALEKNFEIDNKLEPDRKVKLAQELGLQPRQVAIWFQNRRARWK 125
                          56689************************************************9 PP

2HD-ZIP_I/II129.21.7e-4171163193
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          ekkrrls eqvk+LE++Fe ++kLep+rKv+la+eLglqprqva+WFqnrRAR+ktkqlE+dy +Lk+++dalk++++++++++++L  +
  Bostr.0568s0257.1.p  71 EKKRRLSVEQVKALEKNFEIDNKLEPDRKVKLAQELGLQPRQVAIWFQNRRARWKTKQLERDYGVLKSNFDALKRSRDSIQRDNDSLLGQ 160
                          69*************************************************************************************999 PP

          HD-ZIP_I/II  91 lke 93 
                          +ke
  Bostr.0568s0257.1.p 161 IKE 163
                          986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.04E-1960129IPR009057Homeodomain-like
PROSITE profilePS5007117.63767127IPR001356Homeobox domain
SMARTSM003891.0E-1870131IPR001356Homeobox domain
PfamPF000463.3E-1672125IPR001356Homeobox domain
CDDcd000867.70E-1872128No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2074134IPR009057Homeodomain-like
PRINTSPR000317.9E-698107IPR000047Helix-turn-helix motif
PROSITE patternPS000270102125IPR017970Homeobox, conserved site
PRINTSPR000317.9E-6107123IPR000047Helix-turn-helix motif
PfamPF021831.5E-16127168IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MKRSRGSSDS LASFLPIRHS TTDKQISPRP TNTGFLYSGA GDYSQMFDAL EDDGSLEDMG  60
GVGHASSTAA EKKRRLSVEQ VKALEKNFEI DNKLEPDRKV KLAQELGLQP RQVAIWFQNR  120
RARWKTKQLE RDYGVLKSNF DALKRSRDSI QRDNDSLLGQ IKELRAKLNV DGVNGVEENG  180
VVKAAEANQT VMANNEVLEL SHRPPPPPPP QPPHIPTEAP TSELAYEMFS IFPRTESFRE  240
DPADSSDSSA VLNEEYSPTT VEAAGAVAAT AVEMSTMGCF SQFVKMEEHE DLFSGEEACK  300
LFADNEQWYC SDQWNS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119127RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00587DAPTransfer from AT5G65310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3250540.0AF325054.2 Arabidopsis thaliana AT5g65310 (AT5g65310/MNA5_4) mRNA, complete cds.
GenBankAY0742930.0AY074293.1 Arabidopsis thaliana putative homeobox-leucine zipper protein ATHB-5 (At5g65310) mRNA, complete cds.
GenBankAY0913400.0AY091340.1 Arabidopsis thaliana putative homeobox-leucine zipper protein ATHB-5 (HD-zip protein ATHB-5) (At5g65310) mRNA, complete cds.
GenBankX670330.0X67033.1 A.thaliana mRNA Athb-5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010484381.10.0PREDICTED: homeobox-leucine zipper protein ATHB-5-like
SwissprotP466670.0ATHB5_ARATH; Homeobox-leucine zipper protein ATHB-5
TrEMBLR0GN080.0R0GN08_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.666__2__AT5G65310.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM129861526
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.11e-179homeobox protein 5